The below results are produced by the PATKO algorithm when run on FAST search results. PATKO has two adjustable stringency parameters, and the program automaticaly changes these to generate a series of patterns. Note the similarity of these "raw"patterns with the PROSITE pattern. The PATKO patterns can be used in FASTA searches.

    Output from script PATKO run by skerl on Fri Jun 19 13:42:08 1992
    
      Type of input data: fasta
      Input file with fasta results: 93-vs-SP.resfa
      Input file with the query sequence: 93-annexin.query
      List of scoremin values: 0 5 10
      List of treshold values: 0.25 0.50 0.75
      
    LHKAITVKGVDEATIIDILTKRNNAQRQQIKAAYLQEKGKPLDEALKKALTGHLEEVVLALL     Query
    
    L*KAI**KGVDE*TIIDILT*RNNAQRQ*IKAAY***KGK*L***LK*AL*GHLE*VVLALL     0.25  0
    ***A****GVDE*TII*IL**R*N*QRQ*IK**********L***LK**L*G*LE***L*L*     0.50  0
    **********D***************RQ*I****************K***************     0.75  0
    L*KAI**KGVDE*TIIDILT*RNNAQRQ*IKAAY***KGK*L***LK*AL*GHLE*VVLALL     0.25  5
    ***A****GVDE*TII*IL**R*N*QRQ*IK**********L***LK**L*G*LE***L*L*     0.50  5
    **********D***************RQ*I****************K***************     0.75  5
    L*KAI**KGVDE*TIIDILT*RNNAQRQ*IKAAY***KGK*L***LK*AL*GHLE*VVLALL     0.25 10
    ***A****GVDE*TII*IL**R*N*QRQ*IK**********L***LK**L*G*LE***L*L*     0.50 10
    **********D***************RQ*I****************K***************     0.75 10
    
    ----------------------------
    
            TS........L..R...DRQ.....I.......L...L...........L..L      PROSITE
            GT        I      E       F       I   I           I  I      pattern
             V        V      Q       Y       V   V           V  V          for
                      M      N               M   M           M  M      annexin
                      F      H               F   F           F  F